DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and AT2G20270

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001189560.1 Gene:AT2G20270 / 816546 AraportID:AT2G20270 Length:206 Species:Arabidopsis thaliana


Alignment Length:116 Identity:40/116 - (34%)
Similarity:58/116 - (50%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELD------------------------ 63
            |:.|:|.|.||::|||:|.|.:..|..||.|.|:..::|||                        
plant    78 VKTTVAENPVVVYSKTWCSYSSQVKSLFKSLQVEPLVVELDQLVSLGKTSLPHDIGLKHLQKFWW 142

  Fly    64 ----GNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQ 110
                ...:|:::|.||.:|||..|||.|||.||.|||.:|..::...|.|:
plant   143 FLAFPGSEGSQLQNVLEKITGQYTVPNVFIGGKHIGGCSDTLQLHNKGELE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 36/108 (33%)
AT2G20270NP_001189560.1 GRX_GRXh_1_2_like 86..195 CDD:239511 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.