DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and glrx2

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_031755951.1 Gene:glrx2 / 549391 XenbaseID:XB-GENE-963812 Length:161 Species:Xenopus tropicalis


Alignment Length:98 Identity:49/98 - (50%)
Similarity:67/98 - (68%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLGEITGA 81
            |:....::||||.|.|||||||.||||.||||.||.::|..|.:|||...:|.::|..|.:::|.
 Frog    56 TEATDIIKNTIAENCVVIFSKTTCPYCVMAKEAFKNIDVQYTAVELDELENGRQMQVALQQLSGI 120

  Fly    82 RTVPRVFIDGKFIGGGTDIKRMFETGALQKYFQ 114
            ||||:|:::||.||||||.:.:...|.|.|..|
 Frog   121 RTVPQVYVNGKCIGGGTDTRNLEREGKLLKLVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 41/79 (52%)
glrx2XP_031755951.1 GRX_GRXh_1_2_like 70..151 CDD:239511 41/80 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8828
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41098
Inparanoid 1 1.050 104 1.000 Inparanoid score I4819
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - otm49068
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.