DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and GLRX2

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_057150.2 Gene:GLRX2 / 51022 HGNCID:16065 Length:165 Species:Homo sapiens


Alignment Length:115 Identity:51/115 - (44%)
Similarity:71/115 - (61%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAVGSALR-------SPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATI 59
            |...||.|       |.:.:::|.....::.||:.|.|||||||.|.||||||:.|..:||:..:
Human    33 GRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKV 97

  Fly    60 IELDGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGAL 109
            :|||....||:.|..|.::||.|||||:|::|.||||.||..|:.:.|.|
Human    98 VELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 42/79 (53%)
GLRX2NP_057150.2 GRX_GRXh_1_2_like 69..150 CDD:239511 42/79 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159427
Domainoid 1 1.000 74 1.000 Domainoid score I9145
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41098
Inparanoid 1 1.050 98 1.000 Inparanoid score I5026
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - otm41845
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.730

Return to query results.
Submit another query.