DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and CG31559

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_731045.1 Gene:CG31559 / 40749 FlyBaseID:FBgn0051559 Length:454 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:47/97 - (48%) Gaps:27/97 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KVVIFS-------KTYCPYCTMAKE-------PFKKLNVDATIIELDGNPDGNEIQAVLGE--IT 79
            |||:::       :||.. |...|:       .|::.:|..::          |.||.:.:  .:
  Fly   306 KVVLYTTSMGIIRETYTK-CANVKQILRTLLVKFEERDVFMSV----------EYQAEMRQRMQS 359

  Fly    80 GARTVPRVFIDGKFIGGGTDIKRMFETGALQK 111
            |...||:::::|:.||....::||.|:|.|::
  Fly   360 GQVRVPQLYVEGQHIGDAETVERMNESGELRQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 23/95 (24%)
CG31559NP_731045.1 GRX_GRX_like 306..451 CDD:239329 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.