DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and Txnrd3

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001171641.1 Gene:Txnrd3 / 297437 RGDID:1308363 Length:652 Species:Rattus norvegicus


Alignment Length:130 Identity:44/130 - (33%)
Similarity:67/130 - (51%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAVGSALRS----------------PIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEP 49
            :|||...|.|                |..::..:..:.:.:.|..|:|:||||:|||:.:..||.
  Rat    30 LGAVRGGLMSSPPGRRARLTSPGTSRPPAEVREEVRRRLRDLIEGNRVMIFSKSYCPHSSRVKEL 94

  Fly    50 FKKLNVDATIIELDGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQKYFQ 114
            |..|.|:..|:|||...||..:|.||.||:..:|||.:|::...:||...|.:..:.|.|||..|
  Rat    95 FSSLGVNYYILELDQVDDGANVQEVLTEISNQKTVPNIFVNKVHVGGCDRIFQAHQNGLLQKLLQ 159

  Fly   115  114
              Rat   160  159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 33/79 (42%)
Txnrd3NP_001171641.1 GRX_GRXh_1_2_like 76..157 CDD:239511 34/80 (43%)
NADB_Rossmann 163..>195 CDD:304358
TGR 164..652 CDD:273624
Pyr_redox 345..421 CDD:278498
Pyr_redox_dim 524..634 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.