DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and GLRX

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001112362.1 Gene:GLRX / 2745 HGNCID:4330 Length:106 Species:Homo sapiens


Alignment Length:103 Identity:41/103 - (39%)
Similarity:55/103 - (53%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIE---LDGNPDGNEIQAVLGEITGAR 82
            :||...|...|||:|.|..||||..|:|...:|.:...::|   :......||||..|.::||||
Human     4 EFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGAR 68

  Fly    83 TVPRVFIDGKFIGGGTD----------IKRMFETGALQ 110
            |||||||....|||.:|          :.|:.:.||||
Human    69 TVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 38/93 (41%)
GLRXNP_001112362.1 GRX_euk 15..99 CDD:274016 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.