DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and glrx-21

DIOPT Version :10

Sequence 1:NP_649065.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001040891.1 Gene:glrx-21 / 191230 WormBaseID:WBGene00022663 Length:119 Species:Caenorhabditis elegans


Alignment Length:119 Identity:36/119 - (30%)
Similarity:57/119 - (47%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELD-- 63
            ||.|.|.:.   ||:..:|.|       .:.||:::||.|.:|..||:.|..:.|....:.||  
 Worm     1 MGGVTSKVN---VDVVQEQVK-------KDPVVMYTKTSCTFCNRAKDLFSDVRVAYKEVNLDTL 55

  Fly    64 --GNPDGNEIQAVLGEITG------ARTVPRVFIDGKFIGGGTDIKRMFETGAL 109
              ..||.     .||.:.|      ..:||::|:.|:||||.|::..:..:|.|
 Worm    56 KASQPDD-----YLGIVNGLVYTTRQTSVPQIFVCGRFIGGYTELDALRNSGHL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_649065.1 GRX_GRXh_1_2_like 31..111 CDD:239511 28/89 (31%)
glrx-21NP_001040891.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 21..102 CDD:469754 26/85 (31%)

Return to query results.
Submit another query.