DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and glrx-21

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001040891.1 Gene:glrx-21 / 191230 WormBaseID:WBGene00022663 Length:119 Species:Caenorhabditis elegans


Alignment Length:119 Identity:36/119 - (30%)
Similarity:57/119 - (47%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELD-- 63
            ||.|.|.:.   ||:..:|.|       .:.||:::||.|.:|..||:.|..:.|....:.||  
 Worm     1 MGGVTSKVN---VDVVQEQVK-------KDPVVMYTKTSCTFCNRAKDLFSDVRVAYKEVNLDTL 55

  Fly    64 --GNPDGNEIQAVLGEITG------ARTVPRVFIDGKFIGGGTDIKRMFETGAL 109
              ..||.     .||.:.|      ..:||::|:.|:||||.|::..:..:|.|
 Worm    56 KASQPDD-----YLGIVNGLVYTTRQTSVPQIFVCGRFIGGYTELDALRNSGHL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 28/89 (31%)
glrx-21NP_001040891.1 GrxC 21..104 CDD:223767 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R496
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.