DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and F26F4.9

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_498031.3 Gene:F26F4.9 / 175657 WormBaseID:WBGene00017829 Length:235 Species:Caenorhabditis elegans


Alignment Length:114 Identity:32/114 - (28%)
Similarity:52/114 - (45%) Gaps:5/114 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDAT---IIELDG 64
            :..|.|::.|::.:.|..|.|||...|..:|:|.::.||......:......:|.:   :.|.|.
 Worm   120 STSSVLKTSIINKNEKAIKIVENIPDSAPIVVFGESNCPEFRKVCQLVSTYRLDISKFQVFEHDK 184

  Fly    65 NPD--GNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQK 111
            ..|  |.|:..|:......:..|.||:.|:||||...|:....|..|.|
 Worm   185 QSDWPGEEVLKVMENRFKTKKSPYVFVCGEFIGGLEGIRNYDRTHGLDK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 22/84 (26%)
F26F4.9NP_498031.3 Selenoprotein_S 3..>87 CDD:369143
Thioredoxin_like 148..233 CDD:381987 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.