DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and Glrx2

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001381099.1 Gene:Glrx2 / 114022 RGDID:1307950 Length:157 Species:Rattus norvegicus


Alignment Length:112 Identity:46/112 - (41%)
Similarity:69/112 - (61%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAVGSALRSPIVDM----STKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIEL 62
            ||.||.:.:.....    :|.....::.||::|.||||||:.|.||:|||:.|..:||:..::||
  Rat    28 GAAGSGMGNSTSSFWGKSATTPVNQIQETISNNCVVIFSKSSCSYCSMAKKIFHDMNVNYKVVEL 92

  Fly    63 DGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGAL 109
            |....|::.|..|.::||.|||||:|::|.||||..|..|:.:.|.|
  Rat    93 DMVEYGSQFQEALYKMTGERTVPRIFVNGIFIGGAADTHRLHKEGKL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 38/79 (48%)
Glrx2NP_001381099.1 GRX_GRXh_1_2_like 61..142 CDD:239511 38/79 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353471
Domainoid 1 1.000 73 1.000 Domainoid score I9028
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41098
Inparanoid 1 1.050 96 1.000 Inparanoid score I4947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 1 1.000 - - otm45982
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.