DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dysb and DBNDD1

DIOPT Version :9

Sequence 1:NP_001262023.1 Gene:Dysb / 40052 FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_076948.2 Gene:DBNDD1 / 79007 HGNCID:28455 Length:178 Species:Homo sapiens


Alignment Length:149 Identity:32/149 - (21%)
Similarity:59/149 - (39%) Gaps:30/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KAAQIANQISGI--QDQASHQHRIMSELNSSLAGIPTL---IAQLQNSSQVLNSLEEMGKQLE-I 168
            |.|::.....|:  |....:.|..:.|   .:.|||..   :.|:....|.|:|:..:....: :
Human    34 KEAEVPQAALGVPAQGTGDNGHTPVEE---EVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLL 95

  Fly   169 ELEKLEDLREECELQEFILEQQFQ-LSRHKQKKLNELEQ---------YRQQIAQKHQSK-IKDQ 222
            :|.:|.|:.:: ||.|...:...: |:......|:.|.:         .|.:..|.|:.: :.|.
Human    96 DLTELTDMSDQ-ELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDP 159

  Fly   223 EQTLLKLQRERQAVFDDAF 241
                     ||||...|.|
Human   160 ---------ERQATVLDTF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135 19/84 (23%)
DBNDD1NP_076948.2 Dysbindin 36..170 CDD:309545 31/147 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.