DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dysb and Dbndd1

DIOPT Version :9

Sequence 1:NP_001262023.1 Gene:Dysb / 40052 FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_011246811.1 Gene:Dbndd1 / 72185 MGIID:1919435 Length:200 Species:Mus musculus


Alignment Length:193 Identity:38/193 - (19%)
Similarity:74/193 - (38%) Gaps:49/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DDWQQIHGANEKNAEKAAQIANQISGIQDQASHQHRIMSE-------LNSSL------------- 139
            |.|..  .:.:.:|::..::| ::.|.|...|.|..|:.:       ||.|.             
Mouse    19 DRWTA--ASAQLSAQEPGKLA-EVGGPQRATSLQKEIVKDVKVPQAALNVSAHETGDMCRTPVAE 80

  Fly   140 ----AGIPTL---IAQLQNSSQVLNSLEEMGKQLE-IELEKLEDLREECELQEFILEQQFQ-LSR 195
                .|||..   ..|:....|.|:|:..:....: ::|.:|.|:.:: ||.|...:...: |:.
Mouse    81 EEEEVGIPIPAPGFLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQ-ELAEVFADSDDENLAT 144

  Fly   196 HKQKKLNELEQ--------YRQQIAQKHQSKIKDQEQTLLKLQRERQAVFDDAFREDMEEYKQ 250
            .....|:.|.:        :.:..|::::.|....:.       |||....|.|. .:||.|:
Mouse   145 ESPAGLHPLSRASCLRSPSWTKTRAEQNREKQPPSDP-------ERQGTIVDTFL-TVEEPKE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135 25/121 (21%)
Dbndd1XP_011246811.1 PRK13108 <4..93 CDD:237284 15/76 (20%)
Dysbindin 56..192 CDD:367944 25/143 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.