DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dysb and dtnbp1b

DIOPT Version :9

Sequence 1:NP_001262023.1 Gene:Dysb / 40052 FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001038279.2 Gene:dtnbp1b / 556784 ZFINID:ZDB-GENE-060503-889 Length:220 Species:Danio rerio


Alignment Length:88 Identity:24/88 - (27%)
Similarity:48/88 - (54%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QIAQKHQSKIKDQE--QTLLKLQRERQAVFDDAFREDMEEYKQRG--QLTKIQTTSNKLALEEV- 269
            ::..:|..::.:.|  |..:|| ::||..|::||::|||.|...|  |:.:.:.|...::..|| 
Zfish    16 ELELEHAQRVPETEPVQPQVKL-KDRQKFFEEAFQQDMEHYLSTGYLQIAERRETIGSMSSMEVN 79

  Fly   270 -----VLEANEVETKDALEQFLN 287
                 .::..::...:||:.|||
Zfish    80 VDMLEQMDLMDMSDHEALDVFLN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135
dtnbp1bNP_001038279.2 Dysbindin 20..158 CDD:282316 24/84 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582212
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWXP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370127at33208
OrthoFinder 1 1.000 - - FOG0007164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.