powered by:
Protein Alignment Dysb and Dbndd2
DIOPT Version :9
Sequence 1: | NP_001262023.1 |
Gene: | Dysb / 40052 |
FlyBaseID: | FBgn0036819 |
Length: | 288 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041692.1 |
Gene: | Dbndd2 / 52840 |
MGIID: | 106562 |
Length: | 158 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 33/74 - (44%) |
Gaps: | 13/74 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 223 EQTLLKLQRERQAVFDDAFREDMEEY---------KQRGQLTKIQTTS-NKLALEEVVLEANEVE 277
|:..|:| ||||..|:|..:.:.|.. .||..:..|.:.. |...||:| |..::.
Mouse 10 ERQQLRL-RERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQV--EFIDLA 71
Fly 278 TKDALEQFL 286
.:|..:.||
Mouse 72 DQDGADVFL 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167838375 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2BWXP |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.