DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dysb and Dbndd2

DIOPT Version :9

Sequence 1:NP_001262023.1 Gene:Dysb / 40052 FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001041692.1 Gene:Dbndd2 / 52840 MGIID:106562 Length:158 Species:Mus musculus


Alignment Length:74 Identity:21/74 - (28%)
Similarity:33/74 - (44%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 EQTLLKLQRERQAVFDDAFREDMEEY---------KQRGQLTKIQTTS-NKLALEEVVLEANEVE 277
            |:..|:| ||||..|:|..:.:.|..         .||..:..|.:.. |...||:|  |..::.
Mouse    10 ERQQLRL-RERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQV--EFIDLA 71

  Fly   278 TKDALEQFL 286
            .:|..:.||
Mouse    72 DQDGADVFL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135
Dbndd2NP_001041692.1 Dysbindin 12..>80 CDD:398239 18/70 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..158 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838375
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWXP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.