DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dysb and Dbndd1

DIOPT Version :9

Sequence 1:NP_001262023.1 Gene:Dysb / 40052 FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001014178.2 Gene:Dbndd1 / 361437 RGDID:1310008 Length:223 Species:Rattus norvegicus


Alignment Length:218 Identity:40/218 - (18%)
Similarity:78/218 - (35%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ITTPIS-PLGLNESLSSSRSSSLS--LSAPFQLTDGVPSHLNVAAGCSLLAKYEDDWQQIHGANE 105
            :.||:: |:|..||...:....::  :..| |....||:|                         
  Rat    53 LPTPLADPIGRMESPEGAGPGEITKEVKVP-QAAPSVPAH------------------------- 91

  Fly   106 KNAEKAAQIANQISGIQDQASHQHRIMSELNSSLAGIPTL---IAQLQNSSQVLNSLEEMGKQLE 167
               |........::.::::               .|||..   ..|:....|.|:|:..:....:
  Rat    92 ---ETGDTCHTPVAAVEEE---------------VGIPIPAPGFLQVTERRQPLSSVSSLEVHFD 138

  Fly   168 -IELEKLEDLREECELQEFILEQQFQ-LSRHKQKKLNELEQ---YRQQIAQKHQSKIKDQEQTLL 227
             ::|.:|.|:.:: ||.|...:...: |:......|:.|.:   .|.....|.:::...::||  
  Rat   139 LLDLTELTDMSDQ-ELAEVFADSDDENLATESPAGLHPLSRASCLRSPSWTKTRAEQNREKQT-- 200

  Fly   228 KLQRERQAVFDDAFREDMEEYKQ 250
            ....|||....|.|. .:||.|:
  Rat   201 PSDPERQGTIVDTFL-TVEEPKE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135 14/98 (14%)
Dbndd1NP_001014178.2 Dysbindin 79..215 CDD:398239 30/182 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.