DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG18735

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:280 Identity:90/280 - (32%)
Similarity:136/280 - (48%) Gaps:53/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KCAQSQIAFSNQPCSVRN----PKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGH 75
            :||:         ||..|    .:||||.|.|.:|.|:|:.||..|..:||.:::::::.|||.|
  Fly    68 ECAE---------CSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAH 123

  Fly    76 CICNGLQQFMKPAQIQGVVGLHSIR--EYLNGIGNGPDA------LRVDFKNIVPHPQYDCNDVK 132
            |: ||...           .|.::|  |:     |..|:      .||  ..::.||:|...:..
  Fly   124 CV-NGFYH-----------RLITVRLLEH-----NRQDSHVKIVDRRV--SRVLIHPKYSTRNFD 169

  Fly   133 HDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKI 197
            .||||:...:|:|....:.|.|:.:..  .:...:...|:|||...|.   ...||.|::..|.|
  Fly   170 SDIALIRFNEPVRLGIDMHPVCMPTPS--ENYAGQTAVVTGWGALSEG---GPISDTLQEVEVPI 229

  Fly   198 WNNEACERSYRSLGKSNTIGETQLCAGY-ENGQIDSCWADSGGPL----MSKEHHLVGVVSTGIG 257
            .:.|.|..|  :.|:|. |.:..:|||| |.|..|||..|||||:    ....:.|.|:||.|.|
  Fly   230 LSQEECRNS--NYGESK-ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEG 291

  Fly   258 CARPGLPGIYTRVSKYVSWM 277
            ||:|..||:||||..:..|:
  Fly   292 CAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 84/254 (33%)
Tryp_SPc 35..280 CDD:238113 85/256 (33%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/255 (33%)
Tryp_SPc 83..314 CDD:238113 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.