DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and PRSS8

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:264 Identity:88/264 - (33%)
Similarity:132/264 - (50%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PCSVR-NPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQI 90
            ||.|. ..:|.|||.|...:.|:.||:...|.|.|||:::||:|:|:|.||..:  :...:..::
Human    36 PCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPS--EHHKEAYEV 98

  Fly    91 QGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCV 155
            :  :|.|.:..|      ..||.....|:|:|||.|.....:.|||||:|.:||.||.:|:|.|:
Human    99 K--LGAHQLDSY------SEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICL 155

  Fly   156 GSEEGH--RSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGK---SNT 215
            .:....  ..|   :.||:|||....:.:...... |::..|.:.:.|.|...|....|   .:.
Human   156 PAANASFPNGL---HCTVTGWGHVAPSVSLLTPKP-LQQLEVPLISRETCNCLYNIDAKPEEPHF 216

  Fly   216 IGETQLCAGYENGQIDSCWADSGGPLMSKEH---HLVGVVSTGIGCARPGLPGIYTRVSKYVSWM 277
            :.|..:||||..|..|:|..||||||.....   :|.|:||.|..|.....||:||..|.|.||:
Human   217 VQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWI 281

  Fly   278 QKVI 281
            |..:
Human   282 QSKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 82/249 (33%)
Tryp_SPc 35..280 CDD:238113 85/252 (34%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 83/250 (33%)
Tryp_SPc 45..284 CDD:238113 85/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.