DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:278 Identity:84/278 - (30%)
Similarity:132/278 - (47%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVLSLVKCAQSQIAFSNQPCSVRNPKIVGGSEAERNEMPYMVSLMRRG--GHFCGGTIISERWIL 71
            |:..|..|.|:.:..:|           ||.:|.....|:..|:.|..  .|.|||::|::.|:|
Zfish    20 ALCQLDVCGQAPLNNNN-----------GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVL 73

  Fly    72 TAGHCICNGLQQFM--KPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHD 134
            :|.||       ||  ..|.|:..:|    |::..  |:.|:.:......||.||.|......:|
Zfish    74 SAAHC-------FMITATANIKIFLG----RQFQT--GSNPNEISRTLTQIVIHPDYSTTTQNND 125

  Fly   135 IALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGW--GWTHENQAENDRSDVLRKATVKI 197
            ||||.|...:.|:.:|:|.|:.|.:...:     |....|  ||.....::...::||::..:.:
Zfish   126 IALLRLSSSVTFTDYIRPVCLASADSVFA-----GGTKSWITGWDKHRSSDIQVTNVLQEVQLPV 185

  Fly   198 WNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEHH---LVGVVSTGIGCA 259
            .:|..|...|:.:     |.:..:|||...|..|:|..|||||::|:...   ..|:||.|..|.
Zfish   186 VSNTECNADYKGI-----ITDNMICAGINEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECG 245

  Fly   260 RPGLPGIYTRVSKYVSWM 277
            .|..||||||||:|.||:
Zfish   246 LPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 77/250 (31%)
Tryp_SPc 35..280 CDD:238113 79/252 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 78/248 (31%)
Tryp_SPc 37..263 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.