DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and Prss33

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:290 Identity:95/290 - (32%)
Similarity:148/290 - (51%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVFVVAVLSLVKCAQSQIAFSNQPCSVRNPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTII 65
            :|.:|....:.....|.|.::          :.:||||.:|:..|.|:..|:..||.|.|||::|
  Rat    10 LLLVVLGARMQECAACGQPRM----------SSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLI 64

  Fly    66 SERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCND 130
            :.:|:||||||    ..:.:.|::...::|..|:     .:.:..:.|....:.::| |.|..::
  Rat    65 APQWVLTAGHC----FSRRVLPSEYSVLLGALSL-----DVTSSHELLVPVLRVLLP-PDYSEDE 119

  Fly   131 VKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGT---VSGWGWTHENQAENDRSDVLRK 192
            .:.|:|||:|..|:..|:.|||.|:.:...|    ...|:   |:||| :........:...|:.
  Rat   120 ARGDLALLQLSHPVSLSARIQPVCLPAPGSH----PPPGSPCWVTGWG-SLSPGVPLPKGRPLQG 179

  Fly   193 ATVKIWNNEACERSYR---SLGKSNTI---GETQLCAGYENGQIDSCWADSGGPLMSKEHH---L 248
            ..|.:.::.||:|.|.   ::.||..|   |  .|||||..|..|:|..||||||...|..   |
  Rat   180 VRVPLLDSRACDRLYHMGANVPKSERIVLPG--NLCAGYRRGHKDACQGDSGGPLTCMESGRWVL 242

  Fly   249 VGVVSTGIGCARPGLPGIYTRVSKYVSWMQ 278
            |||||.|.|||.|..||:||.|:||..|:|
  Rat   243 VGVVSWGKGCALPNRPGVYTNVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 89/253 (35%)
Tryp_SPc 35..280 CDD:238113 91/256 (36%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 89/254 (35%)
Tryp_SPc 34..272 CDD:238113 90/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.