DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG3916

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:262 Identity:83/262 - (31%)
Similarity:134/262 - (51%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SVRNPKIVGGSEAERNEMPYMVSL-MRRGG---HFCGGTIISERWILTAGHCICNGLQQFMKPAQ 89
            :..:|..:.|.:.....:|:.||| |:|.|   |||||:|:|.:.:|||.||:     :.||...
  Fly    24 TTESPTRINGGQRVNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCM-----EKMKVED 83

  Fly    90 IQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCND-VKHDIALLELVQPIRFS-SHIQP 152
            :..|||  ::.....|:.:     |:..|::  ||||..|. :.:||||:::..|.|.. |.|..
  Fly    84 VSVVVG--TLNWKAGGLRH-----RLVTKHV--HPQYSMNPRIINDIALVKVTPPFRLERSDIST 139

  Fly   153 SCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIG 217
            ..:|..:  |..|:....::|||.|..:.:.....|.|:....:..:||.|.:      |...:.
  Fly   140 ILIGGSD--RIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQ------KGFRVT 196

  Fly   218 ETQLCAGYENGQIDSCWADSGGPLM--SKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKV 280
            ..::||....|| .:|..||||||:  .|:.||||:||.|......|.|.:|||||.::.::.:|
  Fly   197 RNEICALAVQGQ-GACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYISQV 260

  Fly   281 ID 282
            |:
  Fly   261 IN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 80/249 (32%)
Tryp_SPc 35..280 CDD:238113 80/252 (32%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 80/249 (32%)
Tryp_SPc 31..260 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.