DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG17404

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:282 Identity:88/282 - (31%)
Similarity:134/282 - (47%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SNQPCSVRNPKIVGGSEAERNE-MPYMVSLM--RRGG--HFCGGTIISERWILTAGHCICNGLQQ 83
            |.||......:||||::....| :||.|||.  .|||  |||||:||:...||||.|| |.||  
  Fly    24 SRQPSGYTPHRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHC-CQGL-- 85

  Fly    84 FMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSS 148
              ..:::..|.|:..    ||..|:....|....     ||:|. ..|..|:|:|.:..|::.::
  Fly    86 --NASRMSVVAGIRG----LNEKGSRSQVLSYSI-----HPKYQ-ELVTSDLAVLSIKPPLKLNN 138

  Fly   149 HIQPSCVGSEEGHRSLEQEY------GTVSGWGW------------THENQAENDRSDVLRKATV 195
                |.:.:.| :||..:::      .|::|||.            .:.|        ||::.:.
  Fly   139 ----STISAIE-YRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPN--------VLQRMSY 190

  Fly   196 KIWNNEACERSYRSLGKSNTIGETQLCA-GYENGQIDSCWADSGGPL-MSKEHHL--VGVVSTG- 255
            ...:|..|    |:.| ..::.:|::|| |...|   :|..|||||| |..::.|  ||:||.| 
  Fly   191 HTISNSEC----RNAG-MESVTDTEICARGPFRG---ACSGDSGGPLVMESKNGLQQVGIVSYGL 247

  Fly   256 IGCARPGLPGIYTRVSKYVSWM 277
            :.|.....|.:|||||.:..|:
  Fly   248 VVCGLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 84/269 (31%)
Tryp_SPc 35..280 CDD:238113 85/271 (31%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 84/270 (31%)
Tryp_SPc 35..269 CDD:238113 84/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.