DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG4613

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:255 Identity:95/255 - (37%)
Similarity:145/255 - (56%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CSVRN-PKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQ 91
            |.|.| .:||||::...|:.|::..::|....|||||:|::|::|||.||: :|:.  |:...::
  Fly   129 CGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCV-HGMD--MRGVSVR 190

  Fly    92 GVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVG 156
             ::.|.....:| |:...     |.|.:  .|..||...:.||||||.|.|||.....::|:|:.
  Fly   191 -LLQLDRSSTHL-GVTRS-----VAFAH--AHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP 246

  Fly   157 SEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACE-RSYRSLGKSNTIGETQ 220
            | ...::.:.:...|:|||.:.|.   ...|.||::..|.|..|..|. .||||:     |.:|.
  Fly   247 S-NWLQNFDFQKAIVAGWGLSQEG---GSTSSVLQEVVVPIITNAQCRATSYRSM-----IVDTM 302

  Fly   221 LCAGY-ENGQIDSCWADSGGPLMSKEH--HLVGVVSTGIGCARPGLPGIYTRVSKYVSWM 277
            :|||| :.|..|:|..||||||:.::.  .|.||||.|.|||:|..||:|||||:|:.|:
  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 91/245 (37%)
Tryp_SPc 35..280 CDD:238113 92/247 (37%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 91/246 (37%)
Tryp_SPc 137..362 CDD:238113 91/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.