DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG9294

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:266 Identity:83/266 - (31%)
Similarity:133/266 - (50%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CSVRNP--KIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQI 90
            |.:.|.  |||||.|...::.|:|..::.....:|.|::|::.::|||.||             :
  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHC-------------V 143

  Fly    91 QGV-VGLHSIR--EYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSH-IQ 151
            :|| ..|.::|  |:.....|....::.....:..|..|:.....:|:|:|.|.||:....| ::
  Fly   144 EGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLR 208

  Fly   152 PSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACER--SYRSLGKSN 214
            |.|:..:.  .|.:.|.|.|:|||...|.   ...:|.||:..|.:.....|..  :||    ..
  Fly   209 PICLPVQS--YSFDHELGIVAGWGAQREG---GFGTDTLREVDVVVLPQSECRNGTTYR----PG 264

  Fly   215 TIGETQLCAGY--ENGQIDSCWADSGGPLMSK------EHHLVGVVSTGIGCARPGLPGIYTRVS 271
            .|.:..:||||  |.|: |:|..||||||.:.      ::.|.|:||.|:|||||..||:||||:
  Fly   265 QITDNMMCAGYISEGGK-DACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVN 328

  Fly   272 KYVSWM 277
            :|:.|:
  Fly   329 QYLRWL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 80/255 (31%)
Tryp_SPc 35..280 CDD:238113 80/257 (31%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 80/255 (31%)
Tryp_SPc 101..334 CDD:238113 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.