DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and Prss48

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:261 Identity:91/261 - (34%)
Similarity:127/261 - (48%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VRNPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVV 94
            |...:||||.:|.....|:.|||.....|.|||::||:.|:|||.|||......|:..      |
Mouse    35 VHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYS------V 93

  Fly    95 GLHSI-REYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSE 158
            .|.|| ||| :..|......|:...:...|       .:.|||||:|...:.|||.|.|.|:.:.
Mouse    94 WLGSIDREY-SSTGKEYYVSRIAIPDKHRH-------TEADIALLKLSSRVTFSSVILPICLPNI 150

  Fly   159 EGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLG-----KSNTIGE 218
            ....::.... .|:|||   :|| |......|::..|.:.::||||:.|..:|     ....|.|
Mouse   151 SKQLTVPASC-WVTGWG---QNQ-EGHYPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKE 210

  Fly   219 TQLCAGYENGQIDSCWADSGGPL---MSKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKV 280
            ...|||....:.|||..||||||   :.....|:||||.|:.|.: .|||:||.|:.|..|:..:
Mouse   211 DMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGLECGK-DLPGVYTNVTYYQKWISAI 274

  Fly   281 I 281
            |
Mouse   275 I 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 88/250 (35%)
Tryp_SPc 35..280 CDD:238113 89/253 (35%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 88/251 (35%)
Tryp_SPc 40..274 CDD:238113 89/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.