DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and PRSS41

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:274 Identity:85/274 - (31%)
Similarity:134/274 - (48%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NQPCSVR--NPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKP 87
            ::.|..|  :..:.||.|:.|...|:..||..|..|.|||:::|.||:|:|.||    .|:...|
Human    59 SEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHC----FQKHYYP 119

  Fly    88 AQIQGVVG------------LHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLEL 140
            ::....:|            .:|.|..:..|...||||.|               :::|||||.|
Human   120 SEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGV---------------LRNDIALLRL 169

  Fly   141 VQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACER 205
            ...:.::::|||.|:.|.. ...:.:....|:|||....:.........||:|.|.|.||..|..
Human   170 ASSVTYNAYIQPICIESST-FNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNY 233

  Fly   206 SYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEHHL---VGVVSTGIGCARPGLPGIY 267
            .:......:.|.::..|||.|:|.:|:|..||||||:..:..|   ||:||.|:.|.:|..||:|
Human   234 LFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVY 298

  Fly   268 TRVSKYVSWMQKVI 281
            |.:|.|..|:::|:
Human   299 TNISVYFHWIRRVM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 81/256 (32%)
Tryp_SPc 35..280 CDD:238113 82/259 (32%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.