DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG8586

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:330 Identity:91/330 - (27%)
Similarity:138/330 - (41%) Gaps:84/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSLVKCAQS---------------------QIAFSNQPCSVRNPK----------------IVGG 38
            :|.::|::|                     |..|..:.|...|||                |.| 
  Fly   134 ISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKFPYSEDVSIFG- 197

  Fly    39 SEAERNEMPYMVSLMR-RGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREY 102
                  |.|:||.:.. |....||||:|..|.::|..|.:.|.....:  ....|...|:|:.|.
  Fly   198 ------EFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTL--VARAGDWDLNSLNEP 254

  Fly   103 LNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQE 167
            ....|:     |:  |.|:.|.::|.|.:.:|||||.|.:|||.:.||||.|:...|......|.
  Fly   255 YPHQGS-----RI--KEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQL 312

  Fly   168 -----YGTVSGWGWTHENQAENDRSD-VLRKATVKIWNNEACERSYRSLGKSNTIGETQ------ 220
                 |.|  |||   ..:|.:|:.: ||::..:.:...|.|:...|     ||..|.:      
  Fly   313 LSVTCYAT--GWG---TKEAGSDKLEHVLKRINLPLVEREECQAKLR-----NTRLEARFRLRPS 367

  Fly   221 -LCAGYENGQIDSCWADSGGPLMSK------EHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQ 278
             :|||.:.|: |:|..|.|.||..:      .:.|||:||.|:.||...:|.:|..|.....|:.
  Fly   368 FICAGGDPGK-DTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWID 431

  Fly   279 KVIDG 283
            :.|.|
  Fly   432 EKIRG 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 80/277 (29%)
Tryp_SPc 35..280 CDD:238113 80/264 (30%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 79/262 (30%)
Tryp_SPc 197..430 CDD:214473 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.