DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG18563

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:247 Identity:64/247 - (25%)
Similarity:111/247 - (44%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIR--EYLNGIGNGP 110
            ::|:|.....:..||::||.:.||||.|...|.:.:       ..:|    :|  |::....|.|
  Fly   147 WVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNE-------DRIV----VRAGEFVMNTTNEP 200

  Fly   111 DAL--RVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHI----QPSCVGSEEGHRSLEQEYG 169
            ...  || .:.||.|..:......:::||:.:..|...:..|    .||...|.||.|.      
  Fly   201 IQYEERV-VERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGRRC------ 258

  Fly   170 TVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYR--SLGKSNTIGETQLCAGYENGQIDS 232
            ||:||.....:  :..|..:::|..:.:.:...|...:|  :||::..:..:.:||..|..: |.
  Fly   259 TVAGWDLVSSH--DQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINR-DF 320

  Fly   233 CWADSGGPLM----SKEHHL---VGVVSTGIGCARPGLPGIYTRVSKYVSWM 277
            |:...|..|.    .:..|:   .|:|:.|:||.. .||||||.|:.:.||:
  Fly   321 CFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 62/244 (25%)
Tryp_SPc 35..280 CDD:238113 64/247 (26%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 64/247 (26%)
Tryp_SPc 147..371 CDD:214473 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.