DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG4793

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:297 Identity:74/297 - (24%)
Similarity:124/297 - (41%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QSQIAFSNQP----C----------SVRNPKIVGGSEAERNEMPYMVSLM--RRGGHFCGGTIIS 66
            |..:...|||    |          ::.|.:.:    |::.|:|:||:|:  |......||::|:
  Fly    72 QYPVQADNQPLPTECGHVNRIGVGFTITNARDI----AQKGELPWMVALLDSRSRLPLGGGSLIT 132

  Fly    67 ERWILTAGHCICNGLQQFMKPAQI--------QGVVGLHSIREYLNGIGNGPDALRVD--FKNIV 121
            ...:||:.          .|..::        .|.....||.|         :....|  .:.||
  Fly   133 RDVVLTSS----------TKTLEVPEKYLIVRAGEWDFESITE---------ERAHEDVAIRKIV 178

  Fly   122 PHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDR 186
            .|......:..::.|||.|.:|::...||...|:  ...:|:.......|||||  .:...:|..
  Fly   179 RHTNLSVENGANNAALLFLARPLKLDHHIGLICL--PPPNRNFIHNRCIVSGWG--KKTALDNSY 239

  Fly   187 SDVLRKATVKIWNNEACERSYRS-LGKSNTIGETQLCAGYENGQIDSCWADSGGPLM------SK 244
            .::|:|..:.:.:...|:...:. .||...:..:.:|||.|.|: |:|..|.|.||.      ..
  Fly   240 MNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGK-DTCKGDGGAPLACPLQSDPN 303

  Fly   245 EHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281
            .:.|:|:|:.|.||..| ||..||.||:..||:...|
  Fly   304 RYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 65/260 (25%)
Tryp_SPc 35..280 CDD:238113 67/263 (25%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/256 (26%)
Tryp_SPc 105..335 CDD:214473 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.