DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG18478

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:295 Identity:72/295 - (24%)
Similarity:128/295 - (43%) Gaps:31/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVFVVAVLSLVKCAQSQIAFSNQPCSVRNP---KI---VGGSEAERNEMPYMVSLMRRGGHF 59
            ::..:||:.|...|:..|.   .....|...||   |:   |...:|:..|.|:.::::......
  Fly     7 LIVALFVLGVAENVENLQQ---IEELKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLV 68

  Fly    60 CGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHP 124
            .||::|:...:|||.|.|.|        ..::.:|......||.:.:...|.......|.:: |.
  Fly    69 GGGSLITPDIVLTAAHRIFN--------KDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVI-HK 124

  Fly   125 QYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDV 189
            .::.....:::|||.|.:....:..|...|:.:::  |||......|:|||  ....::.....|
  Fly   125 SFNYQRGANNLALLFLDREFPLTYKINTICLPTQK--RSLSSTRCIVAGWG--KYQFSDTHYGGV 185

  Fly   190 LRKATVKIWNNEACERSYRS--LGKSNTIGETQLCAGYENGQIDSCWADSGGPLM------SKEH 246
            |:|..:.|.....|:...|.  ||::.|:....:|||.|... |:|..|.||.|.      .|:.
  Fly   186 LKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDN-DACTGDGGGALFCPMTEDPKQF 249

  Fly   247 HLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281
            ..:|:|:.|:||....:|..||.|.::..|:.:.|
  Fly   250 EQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 62/252 (25%)
Tryp_SPc 35..280 CDD:238113 62/255 (24%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 61/246 (25%)
Tryp_SPc 50..280 CDD:214473 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.