DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:267 Identity:88/267 - (32%)
Similarity:134/267 - (50%) Gaps:28/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CSVRNP------KIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMK 86
            |..:||      :||||..|..:|.|::..|.:.|..||||::|:...||||.||:..     |.
  Fly   387 CGNKNPVTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVAR-----MT 446

  Fly    87 PAQIQGVVGLHSIREYLNGIGNGPDALRVD--FKNIVPHPQYDCNDVKHDIALLELVQPIRFSSH 149
            ...:..:..  .:.:|  .||...:...|.  .|.:|.|..::.:.:.:|:|:|.|.:|:.|:..
  Fly   447 SWDVAALTA--HLGDY--NIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTRE 507

  Fly   150 IQPSCV--GSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGK 212
            |||.|:  ...:..||...:..||:|||...||   ..:..:|:|..:.||.|..|.|.|.....
  Fly   508 IQPICLPTSPSQQSRSYSGQVATVAGWGSLREN---GPQPSILQKVDIPIWTNAECARKYGRAAP 569

  Fly   213 SNTIGETQLCAGYENGQIDSCWADSGGPLMSKE---HHLVGVVSTGIGCARPGLPGIYTRVSKYV 274
            ...| |:.:|||  ....|||..|||||::..:   :..||:||.||||.:...||:||||:..:
  Fly   570 GGII-ESMICAG--QAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLL 631

  Fly   275 SWMQKVI 281
            .|:.|.|
  Fly   632 PWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 82/248 (33%)
Tryp_SPc 35..280 CDD:238113 83/251 (33%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 82/249 (33%)
Tryp_SPc 400..637 CDD:238113 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.