DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG40160

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:121/295 - (41%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NQP--CSVRNPKIVGG----------SEAERNEMPYMVSLMRRG--GHFCGGTIISERWILTAGH 75
            |||  |.|||   .||          :||...|.|:.|:|:..|  .:||.|::|.::.:|||.|
  Fly   146 NQPRGCGVRN---TGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAH 207

  Fly    76 CICNGLQ-------------QFMK---PAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHP 124
            |: ..|:             |.||   |.|.:.|                        :.::.||
  Fly   208 CV-ESLRTGSFTVRAGEWDTQTMKERLPYQERSV------------------------QTVILHP 247

  Fly   125 QYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDR-SD 188
            .|:...:.:|.||:.|.||:....||...|:..::   .:.|...|....||..:......: |.
  Fly   248 DYNRRSIAYDFALVILSQPVTLDDHINVICLPQQD---DIPQPGNTCFSTGWGKDAFGSLGKYSS 309

  Fly   189 VLRKATVKIWNNEACERSYRS--LGKSNTIGETQLCAGYENGQIDSCWADSGGPL-------MSK 244
            ::::..:.|....:|:...|.  ||....:..:.:|||.:.| ||:|..|.|.||       ...
  Fly   310 LMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRG-IDTCQGDGGAPLACPRGSTRES 373

  Fly   245 EHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQK 279
            .:...|:|:.|||| ...:|..|..|:....|:.:
  Fly   374 RYQQTGIVAWGIGC-NDEVPAAYANVALVRGWIDQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 67/279 (24%)
Tryp_SPc 35..280 CDD:238113 68/283 (24%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 66/272 (24%)
Tryp_SPc 169..405 CDD:214473 65/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.