DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG3117

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:252 Identity:65/252 - (25%)
Similarity:117/252 - (46%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLH--S 98
            |.|.:.:.|:.|::.:|..:|.:..||::|:...:|||.|.:..     :.|..|....|..  |
  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAG-----LSPNDIMVRAGEWDLS 152

  Fly    99 IREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRS 163
            ..|.||     |...|...| |:.|..::.:...:|:|||.|..|....::||...:...:  ::
  Fly   153 SSEKLN-----PPMDRQVIK-IMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPD--KT 209

  Fly   164 LEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYR--SLGKSNTIGETQLCAGYE 226
            .::...||:|||.  .:..:.|...:.:|..:.:..:..|:|..|  .:|.:..:..:.:|||.|
  Fly   210 FDRRICTVAGWGM--RSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGE 272

  Fly   227 NGQIDSCWADSGGPLM------SKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWM 277
            .|: |.|....|..|.      ...:...|:||.|:||.:..:|..:|.|||::.|:
  Fly   273 EGR-DVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 64/249 (26%)
Tryp_SPc 35..280 CDD:238113 65/252 (26%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 64/250 (26%)
Tryp_SPc 95..328 CDD:214473 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.