DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG14227

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:248 Identity:65/248 - (26%)
Similarity:108/248 - (43%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQF-------MKPAQIQGVVGLHSIREYLN 104
            |::||::..|...|.|::|:.|::|||.||:.....|.       ..|.| ....|......|  
  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQ-NCSSGARLSNAY-- 118

  Fly   105 GIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYG 169
                   .:|:| |.||..........::||.||.:...:::|..::|.|:...|...::::...
  Fly   119 -------CVRID-KKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQL 175

  Fly   170 TVSGWGWTHENQAENDRS--DVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDS 232
            ||  ||.|    ||:.||  .||:.:.....:.|.|...::     ..:.|:|:|...|...  :
  Fly   176 TV--WGTT----AEDFRSIPRVLKHSVGDRIDRELCTLKFQ-----QQVDESQICVHTETSH--A 227

  Fly   233 CWADSGGPLMSK-------EHHLVGVVSTGI-GCARPGLPGIYTRVSKYVSWM 277
            |..|||||..:|       .....|::..|: .||  || .:.|.|:.|:.|:
  Fly   228 CKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA--GL-SVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 64/245 (26%)
Tryp_SPc 35..280 CDD:238113 65/248 (26%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/246 (26%)
Tryp_SPc 57..277 CDD:238113 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.