DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG33160

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:296 Identity:85/296 - (28%)
Similarity:137/296 - (46%) Gaps:61/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVFVVAVLSLVKCAQSQIAFSNQPCSVR-NPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTII 65
            |..:|:|.:|..      ..|....|.||: .|:|:||..:...|..|:|. :......|||:::
  Fly     6 LTSLFLVQILGF------HSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQ-VTTSEELCGGSLV 63

  Fly    66 SERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGN--GPDAL--RVDFKNIVPHPQY 126
            ..||::||.||:.|..:...|   |.|            |..|  ||.|:  .||:  |...|.:
  Fly    64 KPRWVITAAHCVYNKNKNDFK---IYG------------GASNQAGPYAVIRTVDY--IAIRPDF 111

  Fly   127 DCNDVKHDIALLEL--------VQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAE 183
            :...:..|:|.|.|        ::.|..::...|:        |:|.:    |||||:...:..:
  Fly   112 NRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPA--------RALVK----VSGWGFLTADATK 164

  Fly   184 NDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAG--YENGQIDSCWADSGGPLMSKEH 246
            .  ::.:....|.:|:..:|..::|.:   :.|..:.:||.  |:.   |||..||||||:.: .
  Fly   165 T--AERVHSVLVPMWSRASCVSAFRGI---HRITRSMVCAARLYKK---DSCDGDSGGPLVYR-G 220

  Fly   247 HLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVID 282
            .|.|:||.|.||| ..||||||.|.:...|.|:|::
  Fly   221 QLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 73/255 (29%)
Tryp_SPc 35..280 CDD:238113 75/258 (29%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 73/255 (29%)
Tryp_SPc 34..253 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.