DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and Prss40

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001101679.1 Gene:Prss40 / 316318 RGDID:1561330 Length:376 Species:Rattus norvegicus


Alignment Length:297 Identity:84/297 - (28%)
Similarity:126/297 - (42%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSLVKCAQSQIAFSNQPCSVRNPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGH 75
            ||:| |.::|.          ..||.||..|.....|:..||...|.|.||..:|.:.|:.:|.|
  Rat    58 LSMV-CGKTQF----------QGKIYGGQIAGAQRWPWQASLRLYGRHICGAVLIDKNWVASAAH 111

  Fly    76 CICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPD--ALRVDFKNIVPHPQYDCNDVK-----H 133
            |    .|....|...|.::|...:        |.|.  :.::..|.::.|..|:    |     .
  Rat   112 C----FQMSRNPGDYQIMLGYTKL--------NSPTRYSRKMSVKKLIVHKDYN----KFYPQGS 160

  Fly   134 DIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDV-------LR 191
            ||.||:|...:.:||||.|:||.::......|:...| ||||        |.|.||       |.
  Rat   161 DIVLLQLHSSVEYSSHILPACVPNKNITIPKEKACWT-SGWG--------NLREDVRLPLPNDLY 216

  Fly   192 KATVKIWNNEACERSYRS--LGKSNT--IGETQLCAGYENGQIDSCWADSGGP---LMSKEHHLV 249
            :|.:.|.:|:.|:..:..  .|.|.|  |.:..:||...:.....|..|||||   |:....::|
  Rat   217 EAELIIMSNDDCKGFFPPPVPGSSKTYYIYDDMVCAADYSLTKSICSGDSGGPLVCLLEGSWYVV 281

  Fly   250 GVVSTGIGCARP-GLPGIYTRVSKYVSWMQKVIDGRK 285
            |:.|....|..| ..|.::.|||.:..|   :.|.:|
  Rat   282 GLTSWSSSCEDPISSPSVFARVSYFDKW---ISDNKK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 76/263 (29%)
Tryp_SPc 35..280 CDD:238113 76/266 (29%)
Prss40NP_001101679.1 Tryp_SPc 70..310 CDD:214473 77/267 (29%)
Tryp_SPc 71..313 CDD:238113 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.