DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG33225

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:313 Identity:86/313 - (27%)
Similarity:148/313 - (47%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVAVLSLVKCAQ--SQIAFSNQPCSVRNP----KIVGGSEAERNEMPYMVSLMRRGGHFCGGTII 65
            :|.:.|||..|:  |....:|...:.|:|    ::|||::|:|...|:||.::.....||.|::|
  Fly    23 IVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLI 87

  Fly    66 SERWILTAGHCICNGLQQFMKPAQIQGVVGLH----------SIREYLNGIGNGPDALRVDFKNI 120
            :..::||:..|:.:      .|.|:  ::|.:          |||:.::          :|.|.|
  Fly    88 TRLFVLTSASCLLS------LPKQV--ILGEYDRNCTSADCTSIRQVID----------IDQKII 134

  Fly   121 VPHPQYDCNDV-KHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYG------TVSGWGWTH 178
              |.|:....| |:|||||.|.:.:..|.:::|.|:       |::::.|      |.:|||.|.
  Fly   135 --HGQFGLETVKKYDIALLRLAKKVSISDYVRPICL-------SVDRQVGRSVQHFTATGWGTTE 190

  Fly   179 ENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLM- 242
            .|:.    |.:|:..|:...|.:.|:...|     ..|..:|||.|  ..:.|:|..|:||||. 
  Fly   191 WNEP----STILQTVTLSKINRKYCKGRLR-----QNIDASQLCVG--GPRKDTCSGDAGGPLSL 244

  Fly   243 ------------SKEHHLVGVVSTG-IGCARPGLPGIYTRVSKYVSWMQKVID 282
                        .....|:|:||.| ..|:  |: |:||.|..|:.|:.:.|:
  Fly   245 TLKIDGDGKWNNKSRAFLIGIVSYGSSSCS--GI-GVYTNVEHYMDWIVRTIN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 75/272 (28%)
Tryp_SPc 35..280 CDD:238113 76/275 (28%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 75/273 (27%)
Tryp_SPc 57..292 CDD:238113 76/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.