DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and TPSG1

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:278 Identity:90/278 - (32%)
Similarity:124/278 - (44%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CAQSQIAFSNQPCSVRNPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNG 80
            |.:.|:       |....:||||..|.....|:..||..|..|.|||:::|.:|:|||.||....
Human    51 CGRPQV-------SDAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGS 108

  Fly    81 LQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDF---KNIVPHPQYDCN-DVKHDIALLELV 141
            |..                .:|...:|.....|...|   :.|:.|...... ....||||:||.
Human   109 LNS----------------SDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELS 157

  Fly   142 QPIRFSSHIQPSCV--GSEE---GHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNE 201
            .|:..||.|.|.|:  .|::   |.|.      .|:|||:|.|.:....... ||:..|.:.:.|
Human   158 VPVTLSSRILPVCLPEASDDFCPGIRC------WVTGWGYTREGEPLPPPYS-LREVKVSVVDTE 215

  Fly   202 ACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEHHL---VGVVSTGIGCARPGL 263
            .|.|.|...|.| .:....|||   .|..|:|..||||||:.:.:..   .|.||.|.||.||..
Human   216 TCRRDYPGPGGS-ILQPDMLCA---RGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNR 276

  Fly   264 PGIYTRVSKYVSWMQKVI 281
            ||:||||..||:|:::.|
Human   277 PGVYTRVPAYVNWIRRHI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 85/253 (34%)
Tryp_SPc 35..280 CDD:238113 86/256 (34%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 85/254 (33%)
Tryp_SPc 63..293 CDD:238113 86/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.