DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG30288

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:279 Identity:84/279 - (30%)
Similarity:122/279 - (43%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHS 98
            :|.||.:|.....|:||.:|..|...|||::|:.|::|||.|||        .|..:...:|.:.
  Fly    42 RIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCI--------SPMYMNVRLGEYD 98

  Fly    99 IREYLNGIGNGPDALRVDFKNIVPHPQYDCND---------------VKH-----DIALLELVQP 143
            .|                      ||.:||:|               :.|     ||.||.:.:.
  Fly    99 TR----------------------HPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRS 141

  Fly   144 IRFSSHIQPSC--VGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERS 206
            :.||::::|.|  :|...|...|.......:||| |:.:..|.||   |:.||::.....:|||.
  Fly   142 VIFSNYVRPICLILGKTLGGNPLSILRFNFTGWG-TNSDGEEQDR---LQTATLQQLPQWSCERP 202

  Fly   207 YRSLGKSNTIGETQLCAG-YENGQIDSCWADSGGPLMS-------KEHHLVGVVSTGIG-CARPG 262
            .|.|..|      .:||| |.:   |||..||||||.:       ......||.|.|:. |:  |
  Fly   203 GRPLDIS------YICAGSYIS---DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCS--G 256

  Fly   263 LPGIYTRVSKYVSWMQKVI 281
            | ||||.|:.:..|:..||
  Fly   257 L-GIYTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 81/272 (30%)
Tryp_SPc 35..280 CDD:238113 82/275 (30%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 81/273 (30%)
Tryp_SPc 45..270 CDD:238113 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.