DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG30088

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:137/293 - (46%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFVVAVLSLVKCAQSQIA--FSNQPCSVR-----NPKIVGGSEAERNEMPYMVSLMRRGGHFCGG 62
            :::...:.||  .|.|:|  |....|.|.     ..:||.|.||.....|:|..|.......|||
  Fly    10 IYICMCVCLV--LQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGG 72

  Fly    63 TIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREY--LNGIGNGPDALRVDFKNIVPHPQ 125
            ||||.|:||||.||        |:| .::..:|.|.|...  ..|....|.|...|......:.:
  Fly    73 TIISSRYILTAAHC--------MRP-YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKR 128

  Fly   126 YDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVL 190
            :| ..:.:|||||:|.:.|||:.||||.|:...........|: ...|||.|..|.:.|    ||
  Fly   129 FD-RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEF-QAFGWGQTETNHSAN----VL 187

  Fly   191 RKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEHH-------L 248
            :...:..::|..| ||..|:    .|...|||.|::..  |:|..||||||::|.::       .
  Fly   188 QTTVLTRYDNRHC-RSVLSM----PITINQLCVGFQGS--DTCSGDSGGPLVTKVNYDGVWRYLQ 245

  Fly   249 VGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281
            :|:||.|....:.  ||:||.|..|:.|::.|:
  Fly   246 LGIVSFGDDKCQS--PGVYTYVPNYIRWIRYVM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 84/250 (34%)
Tryp_SPc 35..280 CDD:238113 85/253 (34%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/251 (33%)
Tryp_SPc 45..273 CDD:238113 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.