DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and Acr

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_036622.2 Gene:Acr / 24163 RGDID:2024 Length:437 Species:Rattus norvegicus


Alignment Length:293 Identity:93/293 - (31%)
Similarity:137/293 - (46%) Gaps:28/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVAVLSLVKCAQSQIAFSNQPCSVR---NP----KIVGGSEAERNEMPYMVSLM------RRGGH 58
            |||::..|..........:.||.:|   ||    :||||..:.....|:||||.      .|..|
  Rat     8 VVALVLAVSVVAKDNTTCDGPCGLRFRQNPQAGIRIVGGQTSSPGAWPWMVSLQIFTSHNSRRYH 72

  Fly    59 FCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPH 123
            .|||::::..|:|||.||..|.    .|....:.|.|.|.|....|.....|...|. .:.||.|
  Rat    73 ACGGSLLNSHWVLTAAHCFDNK----KKVYDWRLVFGAHEIEYGRNKPVKEPQQERY-VQKIVIH 132

  Fly   124 PQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSD 188
            .:|:.....:|||||::..|:.....:.|.|:...:...........|:|||:..:|...  .|.
  Rat   133 EKYNAVTEGNDIALLKVTPPVTCGDFVGPGCLPHFKSGPPRIPHTCYVTGWGYIKDNAPR--PSP 195

  Fly   189 VLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKE-----HHL 248
            ||.:|.|.:.:.:.|..:....|:   :..|.:||||..|:||:|..|||||||.::     ..:
  Rat   196 VLMEARVDLIDLDLCNSTQWYNGR---VTSTNVCAGYPEGKIDTCQGDSGGPLMCRDSVDSPFVI 257

  Fly   249 VGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281
            ||:.|.|:||||...||:||....|:.|:...|
  Rat   258 VGITSWGVGCARAKRPGVYTATWDYLDWIASKI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 82/252 (33%)
Tryp_SPc 35..280 CDD:238113 83/255 (33%)
AcrNP_036622.2 Tryp_SPc 42..286 CDD:214473 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D451746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.