DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and CG12256

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:126/269 - (46%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGSEAERNE-MPYMVSL--MRRGG---HFCGGTIISERWILTAGHCICNGLQQFMKPAQIQG 92
            ::|||.:...:| :||.||:  :.|.|   |||||::|:...:|||.||: ||    ...::|..
  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCV-NG----QNASRISV 105

  Fly    93 VVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCND-----VKHDIALLELVQPIRFS----S 148
            |.|:..:.:     .:|       |::.|  ..|:.|:     |..|||:|::..|....    |
  Fly   106 VAGIRDLND-----SSG-------FRSQV--QSYEMNENYQELVTSDIAILKIDPPFELDEKRVS 156

  Fly   149 HIQPS---CVGSEEGHRSLEQEYGTVSGWGWT-HENQAENDR-SDVLRKATVKIWNNEACERSYR 208
            .|..|   .||:       :||. .::|||.. |.......: ..||:|...|..:|..|:.:..
  Fly   157 TIDVSGSDMVGA-------DQEV-LLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT 213

  Fly   209 SLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSK---EHHLVGVVSTGIGCARPGLPGIYTRV 270
            .|      .:|::||....|: .:|..||||||:.|   .:..|||||.|........|.:||||
  Fly   214 QL------TDTEICALERFGK-GACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRV 271

  Fly   271 SKYVSWMQK 279
            |.:..|:::
  Fly   272 SMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 79/264 (30%)
Tryp_SPc 35..280 CDD:238113 80/268 (30%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 79/265 (30%)
Tryp_SPc 47..280 CDD:238113 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.