DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and LOC101884131

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_017209773.1 Gene:LOC101884131 / 101884131 -ID:- Length:293 Species:Danio rerio


Alignment Length:266 Identity:66/266 - (24%)
Similarity:113/266 - (42%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SEAERNEMPYM--VSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIRE 101
            |..:..::|::  ||:....||.|.|.||..:||||..||: |.|.:  :..:|..|.. |.:.:
Zfish    72 SAEDDGKVPWLWHVSISLDSGHHCNGVIIQAQWILTNAHCV-NDLDE--RLLRILSVTA-HGLNK 132

  Fly   102 YLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGS--EEGHRSL 164
            ...      :..|| |.|    ||::.:.:.:::|||:|..|:..|...||:|:.|  :|...||
Zfish   133 QTR------EVFRV-FVN----PQFNSSSLDYNVALLQLSSPLNLSGRTQPACLPSAGQEIPPSL 186

  Fly   165 EQEYGTVSGWG--WT-----HENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLC 222
            :       .|.  ||     ||...:           :.:.....||:..|:     .:..|.||
Zfish   187 Q-------CWTPVWTGQMSGHEQWLK-----------ISVMERAVCEQHQRT-----RLTPTLLC 228

  Fly   223 AGYENGQIDS-----------CWADSGGPLMSKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSW 276
            ||..:|  ||           |..::.|.:      |:|:.|.|........|.:|:.|...:.|
Zfish   229 AGLSSG--DSGVPYWNSGSLYCLTNTSGVV------LMGLKSWGETYGGTQKPAVYSSVPATMHW 285

  Fly   277 MQKVID 282
            :.::::
Zfish   286 ISQMLN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 65/258 (25%)
Tryp_SPc 35..280 CDD:238113 66/262 (25%)
LOC101884131XP_017209773.1 Tryp_SPc 75..288 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.