DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and LOC101731233

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_031752235.1 Gene:LOC101731233 / 101731233 -ID:- Length:245 Species:Xenopus tropicalis


Alignment Length:101 Identity:32/101 - (31%)
Similarity:47/101 - (46%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKE-----HHLV 249
            :::|.|.|...:.|.......||   |.:..|||.|.:...|||..|.||||..:.     :.:|
 Frog     1 MQEAQVNIIPKKTCNSKQWYKGK---IKDFSLCAHYTSENSDSCLGDVGGPLTCRRIDAYTYMVV 62

  Fly   250 GVVSTGIGCARPGLPGIYTRVSKYVSWMQKVIDGRK 285
            |:..:|.||.:...|.:||....|:.|:...|.|.|
 Frog    63 GIAGSGYGCPKEKQPHVYTATQHYIEWIDNKIYGDK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 28/90 (31%)
Tryp_SPc 35..280 CDD:238113 29/94 (31%)
LOC101731233XP_031752235.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D451746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.