DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and LOC100497408

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_031760507.1 Gene:LOC100497408 / 100497408 -ID:- Length:414 Species:Xenopus tropicalis


Alignment Length:297 Identity:88/297 - (29%)
Similarity:152/297 - (51%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVFVVAVLSLVKCAQSQIAFSNQPCSVRNP---------KIVGGSEAERNEMPYMVS---LM 53
            :|.:.|.:.:...:..:::.|.   :.|.:| |         :::.|:..|....|:|.|   |.
 Frog     5 VLLLSFFIFISFFISFSENSIL---KTCGIR-PLVKNHHRVRRVIEGNTPEPGSWPWMASIQMLY 65

  Fly    54 RRG-GHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDF 117
            :.| |..|||.::|.||::||.||: :.|:::...|:|  |:|...:.:.      ||:......
 Frog    66 KDGYGSACGGVLLSNRWVVTAAHCL-SDLKRYRHLARI--VLGARDLTQL------GPETQIRTI 121

  Fly   118 KNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQA 182
            |..:.|..:|....|:||||:.|..|::||.:|||:|:..:..: ..:.:...::|||..  |:.
 Frog   122 KQWIQHEDFDHKTHKNDIALIRLNYPVKFSDYIQPACLPPKSSN-VYKMDDCHIAGWGLL--NEK 183

  Fly   183 ENDRSDVLRKATVKIWNNEACERS--YRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKE 245
            ....:.:|::|||::.:.:.|..|  |     :..|.:..||||||.|..|.|..|||||||.|.
 Frog   184 PRTVTTMLQEATVELIDRKRCNSSDWY-----NGGIHDYNLCAGYEQGGPDVCMGDSGGPLMCKR 243

  Fly   246 -----HHLVGVVSTGIGCARPGLPGIYTRVSKYVSWM 277
                 :::||:||.|..|.:|...|:||.|..:..|:
 Frog   244 KKAGIYYVVGIVSWGGLCGQPHSNGVYTSVQDFEQWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 81/252 (32%)
Tryp_SPc 35..280 CDD:238113 82/254 (32%)
LOC100497408XP_031760507.1 Tryp_SPc 44..280 CDD:238113 81/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D451746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.