DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6865 and LOC100487305

DIOPT Version :9

Sequence 1:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_017946453.2 Gene:LOC100487305 / 100487305 -ID:- Length:396 Species:Xenopus tropicalis


Alignment Length:302 Identity:105/302 - (34%)
Similarity:153/302 - (50%) Gaps:50/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVVAVLSLVKCAQSQIAFSNQPC----------SVRNPKIVGGSEAERNEMPYMVSLMR-RG--- 56
            |..|:..|:..::|.     :.|          |.||.:||||..::....|::||:.. ||   
 Frog    14 FFFAIYVLISISESA-----ETCECGKRPLIKDSQRNSRIVGGVNSQPGAWPWLVSIQAWRGSDY 73

  Fly    57 --GHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKN 119
              ||||||||::.:|||||.||:.:....|   ..|:.|:|...    |:.:|:.....:|  |.
 Frog    74 GYGHFCGGTILNNQWILTAAHCLIDYKTTF---DTIRVVIGARK----LSKLGSETQIRKV--KQ 129

  Fly   120 IVPHPQYDCNDVKH--DIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGT---VSGWGWTHE 179
            ::.|.:| ..:.||  ||.|:.|.:||:|:.:.|.:|:.|    .||.....|   |:|||...|
 Frog   130 LILHEKY-LREGKHSYDIGLILLDEPIKFNDYTQRACLPS----ASLNVAQKTNCYVAGWGVLEE 189

  Fly   180 NQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLM-- 242
            .  |...:|:|::|.|...|.|.|.......||   :....||||::.|:||||..|||||||  
 Frog   190 K--EIAAADILQEAGVFFINKELCNSKEWYNGK---VYPYNLCAGHKEGKIDSCQGDSGGPLMCK 249

  Fly   243 ---SKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281
               |.::.:|||.|.||||||...||||.....:..|::..|
 Frog   250 RKTSNDYIVVGVTSWGIGCARKQRPGIYISTQYFNEWIESKI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 95/257 (37%)
Tryp_SPc 35..280 CDD:238113 96/260 (37%)
LOC100487305XP_017946453.2 Tryp_SPc 47..287 CDD:214473 95/258 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D451746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.