DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LMO2 and Lim1

DIOPT Version :10

Sequence 1:NP_005565.2 Gene:LMO2 / 4005 HGNCID:6642 Length:227 Species:Homo sapiens
Sequence 2:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster


Alignment Length:119 Identity:36/119 - (30%)
Similarity:65/119 - (54%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    99 CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLC 163
            |.||.:.|.|::.|..:::.||..|:.|  |.| |..:..:.:.:..:..||.|:.|.:|..  |
  Fly    27 CAGCNKPILDKFLLNVLERAWHASCVRC--CEC-LQPLTDKCFSRESKLYCRNDFFRRYGTK--C 86

Human   164 ASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDR-YLLINSDIVCEQD 216
            :.|.:.|...::..:.:|||:||.||.|..|:|....|:: |:|.::..:|:.|
  Fly    87 SGCGQGIAPSDLVRKPRDKVFHLNCFTCCICRKQLSTGEQLYVLDDNKFICKDD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LMO2NP_005565.2 LIM1_LMO2 99..154 CDD:188770 16/54 (30%)
LIM2_LMO2 163..218 CDD:188771 18/55 (33%)
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 15/53 (28%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 18/55 (33%)
COG5576 185..324 CDD:227863
Homeodomain 248..304 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.