powered by:
Protein Alignment CG14073 and Cdkn2c
DIOPT Version :9
Sequence 1: | NP_001262022.1 |
Gene: | CG14073 / 40046 |
FlyBaseID: | FBgn0036814 |
Length: | 2133 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571977.1 |
Gene: | Cdkn2c / 54238 |
RGDID: | 2325 |
Length: | 168 |
Species: | Rattus norvegicus |
Alignment Length: | 66 |
Identity: | 22/66 - (33%) |
Similarity: | 36/66 - (54%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1723 NPDQKDNAGYTPLHEACTQGWLEIARILLQYGANHSEAAQSGIRPLHGAIENDHEEVVRLLLSYG 1787
||:.||..|:..:|:|...|:|:..:.||::.|:.:.....|..|||.|.:..|..||..|:.:.
Rat 62 NPNLKDRTGFAVIHDAARAGFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHT 126
Fly 1788 A 1788
|
Rat 127 A 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.