DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14073 and Cdkn2c

DIOPT Version :9

Sequence 1:NP_001262022.1 Gene:CG14073 / 40046 FlyBaseID:FBgn0036814 Length:2133 Species:Drosophila melanogaster
Sequence 2:NP_001288297.1 Gene:Cdkn2c / 12580 MGIID:105388 Length:168 Species:Mus musculus


Alignment Length:66 Identity:22/66 - (33%)
Similarity:36/66 - (54%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1723 NPDQKDNAGYTPLHEACTQGWLEIARILLQYGANHSEAAQSGIRPLHGAIENDHEEVVRLLLSYG 1787
            ||:.||..|:..:|:|...|:|:..:.||::.|:.:.....|..|||.|.:..|..||..|:.:.
Mouse    62 NPNLKDGTGFAVIHDAARAGFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHT 126

  Fly  1788 A 1788
            |
Mouse   127 A 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14073NP_001262022.1 ANK 1697..1807 CDD:238125 22/66 (33%)
ANK repeat 1697..1728 CDD:293786 2/4 (50%)
Ank_2 1702..1790 CDD:289560 22/66 (33%)
ANK repeat 1730..1761 CDD:293786 8/30 (27%)
ANK repeat 1763..1788 CDD:293786 9/24 (38%)
PUFD_like 2016..2129 CDD:271222
Cdkn2cNP_001288297.1 ANK 1 4..33
ANK 37..156 CDD:238125 22/66 (33%)
ANK repeat 37..67 CDD:293786 2/4 (50%)
ANK 2 37..65 2/2 (100%)
ANK repeat 69..100 CDD:293786 8/30 (27%)
ANK 3 69..98 8/28 (29%)
ANK repeat 102..134 CDD:293786 10/26 (38%)
ANK 4 102..132 10/26 (38%)
ANK 5 136..165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.