DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14073 and CDKN2D

DIOPT Version :9

Sequence 1:	NP_001262022.1	Gene:	CG14073 / 40046	FlyBaseID:	FBgn0036814	Length:	2133	Species:	Drosophila melanogaster
Sequence 2:	NP_001791.1	Gene:	CDKN2D / 1032	HGNCID:	1790	Length:	166	Species:	Homo sapiens

Alignment Length:	105	Identity:	32/105 - (30%)
Similarity:	57/105 - (54%)	Gaps:	10/105 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly  1719 RMNMNPDQKDNAGYTPLHEACTQGWLEIARILLQYGANHSEAAQSGIRPLHGAIENDHEEVVRLL 1783
            :...:|:.:|.:|.:|:|:|...|:|:..::|:::||:.:....:|..|:|.|::..|..||..|
Human    62 KQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFL 126

  Fly  1784 LSYGADPLLATYSGQTPLMLASSKLMRG------ILRAHL 1817
            .: .:|.......|.|||.||   |.||      ||:.|:
Human   127 AA-ESDLHRRDARGLTPLELA---LQRGAQDLVDILQGHM 162

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14073	NP_001262022.1	ANK	1697..1807	CDD:238125	26/87 (30%)
		ANK repeat	1697..1728	CDD:293786	1/8 (13%)
		Ank_2	1702..1790	CDD:289560	19/70 (27%)
		ANK repeat	1730..1761	CDD:293786	9/30 (30%)
		ANK repeat	1763..1788	CDD:293786	8/24 (33%)
		PUFD_like	2016..2129	CDD:271222
CDKN2D	NP_001791.1	ANKYR	<16..131	CDD:223738	19/69 (28%)
		ANK repeat	41..71	CDD:293786	1/8 (13%)
		ANK 1	41..69		1/6 (17%)
		ANK repeat	73..104	CDD:293786	9/30 (30%)
		ANK 2	73..102		9/28 (32%)
		Ank_2	79..158	CDD:403870	25/82 (30%)
		ANK repeat	106..136	CDD:293786	9/30 (30%)
		ANK 3	106..135		9/29 (31%)
		ANK 4	138..166		12/28 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	1	0.960