DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz-f1 and Hr83

DIOPT Version :9

Sequence 1:NP_524143.2 Gene:ftz-f1 / 40045 FlyBaseID:FBgn0001078 Length:1027 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:123 Identity:50/123 - (40%)
Similarity:66/123 - (53%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA-ERSCHIDKTQRKRCPYCRFQKCLEV 571
            |.||||:.||.|||:..|:.|..||||:|:....|.|:| ..:|.:||.:|..||.||||:||.|
  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71

  Fly   572 GMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGPDIKPTPIS 629
            ||...||:.:  ||.||:...:|:..|.             ||..:...|  .|||.|
  Fly    72 GMNAAAVQEE--RGPRNQQVALYRTGRR-------------QAPPSQAAP--SPTPHS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftz-f1NP_524143.2 NR_DBD_Lrh-1_like 508..600 CDD:143541 43/92 (47%)
NR_LBD_Ftz-F1_like 794..1024 CDD:132742
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 41/82 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.