DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz-f1 and nhr-38

DIOPT Version :9

Sequence 1:NP_524143.2 Gene:ftz-f1 / 40045 FlyBaseID:FBgn0001078 Length:1027 Species:Drosophila melanogaster
Sequence 2:NP_501728.2 Gene:nhr-38 / 191720 WormBaseID:WBGene00003629 Length:355 Species:Caenorhabditis elegans


Alignment Length:160 Identity:52/160 - (32%)
Similarity:83/160 - (51%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHI--DKTQR-KRCPYCRFQ 566
            |.:|.:|.||..|||:|.::|.:|..||:|:|.::|||:| :.|.|.|  |.|:| ..|.:|||.
 Worm    30 EMICSICSDKAEGYHFGAISCAACGAFFRRSVSDQKVYSC-SNRQCSIVHDPTKRGGSCRFCRFL 93

  Fly   567 KCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGPDIKPTPISPG 631
            ||:..||..:.|:|.|....:.....:|:......:.::.|    :.|.|.|:..:   .||...
 Worm    94 KCVSSGMMPQDVKAKRTSSSQQNVTSLYRNMNQSSILLIDQ----IIAFRRSIAAE---RPIFDL 151

  Fly   632 YQQAYPNMNIK----QEIQIPQVSSLTQSP 657
            ..::....|:|    ||.:|.:..| |.||
 Worm   152 ISRSTTRTNLKISLHQEYEIMRRIS-TGSP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftz-f1NP_524143.2 NR_DBD_Lrh-1_like 508..600 CDD:143541 36/94 (38%)
NR_LBD_Ftz-F1_like 794..1024 CDD:132742
nhr-38NP_501728.2 ZnF_C4 32..102 CDD:197701 32/70 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.